LL-37 5MG

$59.00

The products available here are designed exclusively for research and laboratory use. They are not approved for human or animal consumption. These items are not classified as medicines or drugs and have not been evaluated or approved by the U.S. Food and Drug Administration (FDA) for the diagnosis, treatment, cure, or prevention of any disease or medical condition.

LL-37 5MG is available in lyophilized form for research-only use. Verified for purity and sequence through independent analysis.

Out of stock

Email when stock available

Payment Types Accepted

  • Check Mark Secure Credit Cards
  • Visa Card
  • MasterCard
Pay With

🛡️ LL-37 5MG

Available to order right here on Southern Aminos. Formulated using strict quality standards to guarantee potent compounds free from impurities and contamination.

🔍 Key Features

  • 🧬 Premium Purity
  • 📉 Third-Party Testing
  • 🧪 Sterilized Vials
  • ⚙️ Lyophilized Format: Stable and reconstitutable with minimal degradation
Product Name LL-37
CAS Number 22150-29-6
Sequence [LL-37, 37 aa]
Molecular Formula C₁₉₈H₃₁₇N₅₅O₅₀
Molecular Weight 4493.26 g/mol
Purity ≥98% (HPLC validated)
Synthesis Method Solid-phase peptide synthesis (SPPS)
Format Lyophilized powder
Appearance White to off-white crystalline powder
Solubility Soluble in sterile water or PBS
Stability & Storage −20°C for 24 months; post-reconstitution: 4°C ≤7 days −20°C ≤3 months
Shipping Conditions Ambient temperature; refrigerate upon receipt
Regulatory Status For research use only; non-therapeutic grade

The products offered by Coast Peptides are intended strictly for laboratory research purposes only and are sold exclusively to qualified professionals, institutions, and entities. These products are not for human consumption, veterinary use, or any other application involving living organisms, including but not limited to diagnostic, therapeutic, or recreational purposes.

By purchasing this product, you confirm that:

  • You are a qualified professional or entity with the necessary knowledge, training, and facilities to handle chemical reagents safely and appropriately.
  • You will use this product in full compliance with all applicable local, state, and federal laws and regulations.

 

Prohibited Uses:

 

  • This product is not to be used as an active pharmaceutical ingredient (API) in compounding or manufacturing drugs for human or veterinary use.
  • It is strictly prohibited to use this product for administration to humans or animals under any circumstances.
  • Coast Peptides does not condone or permit the use of its products for the development, testing, or production of illegal substances.

Regulatory Compliance:

Coast Peptides does not claim that this product is approved by the U.S. Food and Drug Administration (FDA) for any purpose. The statements regarding this product have not been evaluated by the FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.

Liability Statement:

The buyer assumes full responsibility for ensuring the safe handling, storage, and use of this product. Coast Peptides is not liable for any damages, direct or indirect, resulting from improper handling, storage, or unauthorized use of this product. Furthermore, Coast Peptides reserves the right to refuse sales to any individual or entity suspected of misusing its products.

If you have questions about the safe and lawful use of this product, consult a qualified professional with expertise in laboratory research. By proceeding with this purchase, you agree to these terms and conditions.

Weight 1 oz
MG

5mg

Refer a researcher to Southern Aminos! Earn together

Invite your colleagues and earn a 15% discount on your next purchase. The researcher also earns a 10% discount! Get started now, by sharing your referral link with your colleagues.

Refer researchers to Southern Aminos! Earn together

Invite your colleagues and earn a 10% discount on your next purchase. Your colleague also earns a 10% discount! Get started now, by sharing your referral link with your colleagues.

Refer a researcher to Southern Aminos! Earn together

Invite your colleagues and earn a 15% discount on your next purchase. The researcher also earns a 10% discount! Get started now, by sharing your referral link with your colleagues.

You receive15%
Researcher receives10%